LL-37 (5mg)

$40.00

LL-37 (5mg)- Product will arrive in a lyophilized (powder) form for maximum stability.

LL-37 is a 37-amino acid, cationic antimicrobial peptide that originates from the cleavage of the human cathelicidin precursor protein hCAP18 (human cationic antimicrobial protein 18). It plays a crucial role in the body’s innate immune defense system by protecting against a wide range of pathogens including bacteria, fungi, and viruses. Beyond its antimicrobial activity, LL-37 is also involved in immune modulation, wound healing, angiogenesis, and tissue repair, making it a subject of growing interest in medical research and peptide therapeutics.

In stock

LL-37 (5mg)- Product will arrive in a lyophilized (powder) form for maximum stability.

LL-37 is a 37-amino acid, cationic antimicrobial peptide that originates from the cleavage of the human cathelicidin precursor protein hCAP18 (human cationic antimicrobial protein 18). It plays a crucial role in the body’s innate immune defense system by protecting against a wide range of pathogens including bacteria, fungi, and viruses. Beyond its antimicrobial activity, LL-37 is also involved in immune modulation, wound healing, angiogenesis, and tissue repair, making it a subject of growing interest in medical research and peptide therapeutics.

LL-37 functions by disrupting microbial membranes through its amphipathic and positively charged structure, leading to rapid pathogen clearance. Additionally, it has been studied for its ability to regulate inflammatory responses, promote cell proliferation, and influence processes such as skin regeneration, bone healing, and cardiovascular health.

Weight 0.02 lbs
Dimensions 4 × 6 × 0.5 in
PRODUCT INFORMATION

Form: Lyophilized powder
Unit size: 5mg/vial
Unit quantity: 1 vial
Vial size: 3ml

CHEMICAL PROFILE

Molecular Formula: C205H340N60O53
Molecular Weight: 4493 g/mol
Peptide Sequence: [LL-37, 37 aa]
CAS number: 154947-66-7

Reviews

There are no reviews yet.

Be the first to review “LL-37 (5mg)”

Your email address will not be published. Required fields are marked *

You may also like…